Protein Info for BPHYT_RS15760 in Burkholderia phytofirmans PsJN

Annotation: nickel transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 78 to 103 (26 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 260 to 286 (27 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details PF03824: NicO" amino acids 40 to 327 (288 residues), 330.1 bits, see alignment E=6.2e-103 TIGR00802: transition metal uptake transporter, Ni2+-Co2+ transporter (NiCoT) family" amino acids 43 to 322 (280 residues), 392.9 bits, see alignment E=4.4e-122

Best Hits

KEGG orthology group: K07241, high-affinity nickel-transport protein (inferred from 100% identity to bpy:Bphyt_3174)

Predicted SEED Role

"HoxN/HupN/NixA family nickel/cobalt transporter" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6K2 at UniProt or InterPro

Protein Sequence (339 amino acids)

>BPHYT_RS15760 nickel transporter (Burkholderia phytofirmans PsJN)
MTPTASLRPRLFTLYAVLIAANLGAWAWALIAFRHYPLLLGTALLAYGFGLRHAVDADHI
AAIDAVTRKLMQTGKRPLGVGLSFSLGHSTIVILATIGIAWTAHSLHGRFETFKAVGGTI
GTLVSASFLLMLAAVNLVILRDVWRRYRHVQRGGELPAHTPDSIAPAGLLSRALRPLFRL
VTKSWHMYPVGVLFGLGFDTATEIGLLAIAASEAGKGLPLYSILVFPALFTAGMTLVDST
DNVLMVHAYGWAMDDPKRKLYYNASITFVSAVVAIVIGGVEALGLLSDKLGLNGGVWNAV
ASVNERFGALGYGIVAMFMACWIGSVLFHRWRRPDAVAR