Protein Info for BPHYT_RS15755 in Burkholderia phytofirmans PsJN

Annotation: mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00190: Cupin_1" amino acids 64 to 145 (82 residues), 31 bits, see alignment E=2.6e-11 PF07883: Cupin_2" amino acids 64 to 136 (73 residues), 43.7 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3173)

Predicted SEED Role

"Predicted mannose-6-phosphate isomerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6K1 at UniProt or InterPro

Protein Sequence (171 amino acids)

>BPHYT_RS15755 mannose-6-phosphate isomerase (Burkholderia phytofirmans PsJN)
MSQDHEHPHYKDVPPAAPVDWREHGVKVIKGDQLDTNTAQTPGMNRAAAINAARVGAQKI
WAGTVTIHPNAKTGAHHHGALESVIYVVRGQARMRWGEHLEFTAEAGPGDFIFVPPYVPH
QEINASTDDPLECVLVRSDNEAVVVNLNIDAVEQPETVFWVDPIHKHPHDH