Protein Info for BPHYT_RS15750 in Burkholderia phytofirmans PsJN

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 TIGR00484: translation elongation factor G" amino acids 1 to 700 (700 residues), 1215.9 bits, see alignment E=0 TIGR00231: small GTP-binding protein domain" amino acids 9 to 187 (179 residues), 109.4 bits, see alignment E=1.6e-35 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 213.1 bits, see alignment E=6.8e-67 PF03144: GTP_EFTU_D2" amino acids 329 to 396 (68 residues), 72.1 bits, see alignment E=1e-23 PF14492: EFG_III" amino acids 409 to 483 (75 residues), 118.5 bits, see alignment E=2.7e-38 PF03764: EFG_IV" amino acids 484 to 604 (121 residues), 165.6 bits, see alignment E=9.8e-53 PF00679: EFG_C" amino acids 606 to 693 (88 residues), 108.4 bits, see alignment E=3.7e-35

Best Hits

Swiss-Prot: 97% identical to EFG1_PARXL: Elongation factor G 1 (fusA1) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02355, elongation factor G (inferred from 90% identity to bch:Bcen2424_2528)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6K0 at UniProt or InterPro

Protein Sequence (701 amino acids)

>BPHYT_RS15750 elongation factor G (Burkholderia phytofirmans PsJN)
MPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWKGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQ
PQSETVWRQANKYKVPRIAFVNKMDRVGADFFRVQRQIGDRLKGNAVPIQIPVGAEDHFQ
GVVDLVKMKAIYWDEENQGIKFEYRDIPPELAATAKEWHDKMVEAAAEANEELLDKYLGG
ETLTEEEIKYGIRTRCIANEIVPMLCGSAFKNKGVQAMLDAVIDYLPSPVDVPAITGHDE
YDKEIERHPTDTDPFSALAFKIMTDPFVGQLIFFRVYSGVVNSGDTVYNAVKEKKERLGR
ILQMHANERKEIKEVYAGDIAAAVGLKEATTGDTLCDPNNVIILERMIFPEPVISQAVEP
KTKVDQEKMGIALNRLAQEDPSFRVQTDEESGQTIISGMGELHLEILVDRMKREFGVEAT
VGKPQVAYRETVRNKVEDVEGKFVKQSGGRGQYGHAVITLEPAPQGKGYEFVDAIKGGVI
PREYIPAVDKGIVETLKAGVLAGYPVVDVKVTLTFGSYHDVDSNENAFRMAGSMAFKEAM
RKAKPVLLEPMMAVEVETPEDFMGNVMGDLSSRRGMVQGMEDIAGGGGKLVRAEVPLAEM
FGYSTSLRSATQGRATYTMEFKHYAETPSNVAEAVINAKHK