Protein Info for BPHYT_RS15710 in Burkholderia phytofirmans PsJN

Annotation: ATP-dependent Clp protease ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 765 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 737 (735 residues), 1109.5 bits, see alignment E=0 PF02861: Clp_N" amino acids 13 to 61 (49 residues), 55.2 bits, see alignment 3.7e-18 PF00004: AAA" amino acids 214 to 345 (132 residues), 48.6 bits, see alignment E=7e-16 amino acids 495 to 610 (116 residues), 49.1 bits, see alignment E=4.8e-16 PF17871: AAA_lid_9" amino acids 353 to 455 (103 residues), 96.6 bits, see alignment E=4.5e-31 PF07724: AAA_2" amino acids 489 to 649 (161 residues), 198.2 bits, see alignment E=6.1e-62 PF00158: Sigma54_activat" amino acids 493 to 614 (122 residues), 24.2 bits, see alignment E=1.5e-08 PF07728: AAA_5" amino acids 494 to 611 (118 residues), 48.6 bits, see alignment E=5.2e-16 PF10431: ClpB_D2-small" amino acids 656 to 736 (81 residues), 82.3 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 61% identical to CLPA_ECOLI: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli (strain K12)

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 96% identity to bph:Bphy_0569)

MetaCyc: 61% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6J3 at UniProt or InterPro

Protein Sequence (765 amino acids)

>BPHYT_RS15710 ATP-dependent Clp protease ATP-binding protein (Burkholderia phytofirmans PsJN)
MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRN
FIHDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDSH
AVYYLQQQGVTRLDVVNFISHGIAKTSSTDAAKASDANAESDEAAAQKETPLAQFTQNLN
QMAKDGRIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTAIAEGLAWRITRGEVP
DILADAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPHAILFIDEIHTLIGAGAAS
GGTLDASNLLKPALSSGTLKCIGATTFTEYRGIFEKDAALSRRFQKVDVTEPTVEQTVAI
LRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVIDEAGAAQRILPKSKQ
KKTIGKNEIEEIISKIARVPPQSVSQDDRSKLQTLDRDLKSVVFGQDPAIDALSAAIKMA
RAGLGKLDKPIGAFLFSGPTGVGKTEVAKQLAFTLGIELIRFDMSEYMERHAVSRLIGAP
PGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVMDHGTLTDNNGRKADFR
NVIIIMTTNAGAEAMGKSVIGFTNRRETGDEMVDIKRMFTPEFRNRLDATISFRSLDEEI
IMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGARPMQRLIQDTIRRALA
DELLFGKLMNGGRVSVDVDAEDKVQLTFDEHPAPRNPNPEAVEIE