Protein Info for BPHYT_RS15585 in Burkholderia phytofirmans PsJN

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13527: Acetyltransf_9" amino acids 9 to 135 (127 residues), 25.4 bits, see alignment E=4.7e-09 PF13480: Acetyltransf_6" amino acids 14 to 116 (103 residues), 29.1 bits, see alignment E=3.5e-10 PF00583: Acetyltransf_1" amino acids 24 to 134 (111 residues), 67.6 bits, see alignment E=4.2e-22 PF13673: Acetyltransf_10" amino acids 45 to 137 (93 residues), 41.5 bits, see alignment E=4.3e-14 PF12568: PanZ" amino acids 47 to 137 (91 residues), 23.6 bits, see alignment E=1.1e-08 PF13508: Acetyltransf_7" amino acids 54 to 135 (82 residues), 55.5 bits, see alignment E=2.2e-18 PF08445: FR47" amino acids 77 to 137 (61 residues), 30 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 44% identical to Y1169_YERE8: Acetyltransferase YE1169 (YE1169) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3140)

Predicted SEED Role

"Acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6G8 at UniProt or InterPro

Protein Sequence (156 amino acids)

>BPHYT_RS15585 acetyltransferase (Burkholderia phytofirmans PsJN)
MTTSATLSIRRFEASDTDAVIALWQQAFPEYRDVTRPQRDPHLSIANKLATQPELFFVAV
LGERIAGTVMGGYDGHRGWLYSLAVDESLRRHGIGTRLVAHVENALTERGCPKLNLQVLS
AKADIRAFYEALGYRADAVISLGKRLGEFADAAPAA