Protein Info for BPHYT_RS15535 in Burkholderia phytofirmans PsJN

Annotation: glutathione ABC transporter substrate-binding protein GsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00496: SBP_bac_5" amino acids 77 to 434 (358 residues), 332.6 bits, see alignment E=1.6e-103

Best Hits

Swiss-Prot: 66% identical to GSIB_PECAS: Glutathione-binding protein GsiB (gsiB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K13889, glutathione transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_3130)

MetaCyc: 64% identical to glutathione ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein" (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6F8 at UniProt or InterPro

Protein Sequence (520 amino acids)

>BPHYT_RS15535 glutathione ABC transporter substrate-binding protein GsiB (Burkholderia phytofirmans PsJN)
MNLLVPSSPFRLRALISGGAVVFAMLAGNAAHADTTAVMAVASTFTTLDPYDANDTLSQA
VAKSFYQGLFGFDKDMKLVNVLADSYEASPDAKVYTFKLRHGVKFQDGTDFNAAAVKANF
DRVTDPANKLKRYNMFNRIEKTEVVDPYTVKITLKAPFSAFVNVLAHPSAVMISPDALKK
YGKDIAFHPVGTGPFELVKWDPAGDLTVKKFAGYWKKGYPKVDAIDWKPVVDNNTRAALM
RTGEADFAFQVPFEQAAQLQTSPKVDLIASPSIIQRYISLNVNQKPFDNPKVREALNYAV
NKDALTKVVFAGYATPADGVVPQGVDYAVKQGPWPYDPAKARALLKEAGYPNGFETTLWS
AYNYSTAQKVIQFVQQQLAQVGIKAQVEALEAGQRVAKVESAQDAATAPVRMYYAGWSSS
TGEADWAITPLLASVSFPPKMVNTAYYKNDTVDSDLKQALETTDRTKKAELYTDAQKRIW
ADAPWIFLVKEKVVYARSKRLSGAYVAPDGSFNFDEIAIK