Protein Info for BPHYT_RS15105 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF01494: FAD_binding_3" amino acids 11 to 333 (323 residues), 70.5 bits, see alignment E=7.4e-23 PF00890: FAD_binding_2" amino acids 12 to 43 (32 residues), 23.7 bits, see alignment (E = 1.2e-08) PF07992: Pyr_redox_2" amino acids 12 to 96 (85 residues), 26.1 bits, see alignment E=2.5e-09 PF03486: HI0933_like" amino acids 12 to 42 (31 residues), 24.3 bits, see alignment (E = 5.7e-09) PF12831: FAD_oxidored" amino acids 12 to 173 (162 residues), 39.6 bits, see alignment E=2e-13 PF04820: Trp_halogenase" amino acids 12 to 85 (74 residues), 35.2 bits, see alignment E=3e-12 amino acids 104 to 361 (258 residues), 52 bits, see alignment E=2.5e-17 PF13450: NAD_binding_8" amino acids 15 to 44 (30 residues), 32.3 bits, see alignment (E = 4.4e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3046)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T674 at UniProt or InterPro

Protein Sequence (414 amino acids)

>BPHYT_RS15105 FAD-dependent oxidoreductase (Burkholderia phytofirmans PsJN)
MSTHSSKRTTVDVVIIGAGPAGAVAAALLRKAGRSVLVLERQHFPRFSIGESLLPQSMAY
LEEAGMLRAVVEAGFQYKNGAHFVYRDQSSAFDFRDKHSPGWGTTYQVERAVFDDILIRC
AAEQGADVRFGHTVRAVHTGATPLVDVIDEADHAYQIEARFVFDASGFGRVLPRLLNLEA
PTRMPTRAAIFTHVQDGIPAGMTDRNKICVATHPEHRDVWFWMIPLAGGRSSVGCVAEAS
FLDVPDAERDAKLRALIQQEPTLNRLIGNAPFLMPVRHIGGYAANVERLHGPGYALLGNA
GEFLDPVFSSGVTIALRSAHLAVQTLNRHLDGEQVDWSAAYDVPLRKGIDTFRAFVERWY
SGALQDIIFYPEQTPSIRRMISAVLAGYAWDETNPYVADPVRRLNALHEVCMQR