Protein Info for BPHYT_RS15060 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 25 to 42 (18 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 398 (366 residues), 155.1 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 48% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3036)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T664 at UniProt or InterPro

Protein Sequence (449 amino acids)

>BPHYT_RS15060 MFS transporter (Burkholderia phytofirmans PsJN)
MNSPSLSAADASSDAWLEAAALRKITWRIMPFLFLVYVLSYLDRVNIGYAKLQFTGDLGL
SNAAYGLGAGIFFFGYFVFEVPSNLLLKKFGARATIARITMLWGLLSCLMMFVRTETMFY
VLRFFLGVAEAGLVPGVVLYLTFWFPSDRRARMVAVFMAAIPVAGIIGAPLSGFLMSALH
EAHGLRGWQWMFLIEGIPSILAGFWALAVLRNTPAEAAWLTDDEKRVILGRLARENTAAA
AAGAEHSLAVALRSGRFWLLTLIYFCLVTGNAGFSFWLPQIVKDLGVTNLVTNGFVTAIP
YLAAGIGMILIGRSSDITGERRWHYAVCCFIGAAGLLGSASVTNSIPLAVTGLSIAYVGI
LAGFGIFWSMSTTFLQGTAAVAGIAVINSIANLAGYVSPYVLGIVKDATHSVTFGLVLIA
GALIVGGLVTLMMPRVKVQQTAAVAPSRA