Protein Info for BPHYT_RS15025 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 56 to 81 (26 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 22 to 428 (407 residues), 93.1 bits, see alignment E=1.9e-30 PF07690: MFS_1" amino acids 24 to 382 (359 residues), 97.2 bits, see alignment E=9.6e-32 amino acids 281 to 426 (146 residues), 42.4 bits, see alignment E=4.5e-15

Best Hits

Swiss-Prot: 62% identical to CITA_ECOLX: Citrate-proton symporter (citA) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3029)

MetaCyc: 62% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T657 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BPHYT_RS15025 major facilitator transporter (Burkholderia phytofirmans PsJN)
MSTATHATSTSQESKVKTVFRVVSGNFLEMYDFMVYGYYASAIAKTYFPSGNEFASLMLS
LSVFGAGFLMRPLGAIVLGAYIDHHGRRKGLILTLGLMALGTLTVASIPGYATIGLLAPV
LVLGGRLLQGFSAGVELGGVSVYLSEIATKGNKGFYCAWQSGSQQVAVVFAALIGVFLNK
LLPADQMTAWGWRVPFLIGCLIVPFLFLIRRSLQETEEFKARKHHPKMGEIMKTMAANWG
IVLGGMGMVIMTTVSFYMITAYTPTFGKEVLKLSSIDTLIVTVCIGLSNLVWLPLAGALS
DRIGRRPVLLAFTILTILTAYPALQWLVADPSFARLLEVELWLSFLYGSYNGGMVVALTE
VMPVEVRTAGFSLAYSLATTIGGFTPAISTLLIHSTGNKAAPGLFLGAAAICGLIATLVL
YRTPESRNQYRTA