Protein Info for BPHYT_RS14730 in Burkholderia phytofirmans PsJN

Annotation: GTPase RsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00157: ribosome small subunit-dependent GTPase A
  • amino acids 52 to 308 (257 residues), 208.2 bits, E=7.1e-66
• PF03193: RsgA_GTPase
  • amino acids 73 to 250 (178 residues), 174.8 bits, E=7.8e-56

Best Hits

Swiss-Prot: 100% identical to RSGA_PARPJ: Small ribosomal subunit biogenesis GTPase RsgA (rsgA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 100% identity to bpy:Bphyt_2970)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See B2T600 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BPHYT_RS14730 GTPase RsgA (Burkholderia phytofirmans PsJN)
MSGRSPKAPRAPSSTRVGGLVVAAHGRHYLVAPDDGGAMLQCFPRGKRSEVAVGDRVVYE
LASADQGVIVEIGERRNLLYRSDQYKSKLFAANLDQLLVVLATEPHFSEDLLGRALVAAE
ANELKPLIVLNKTDVTDALEGARKRLEPYRALGYTVVEVSIKMQPEAARAALIEHLQGHS
TLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLPDSADGEGGALI
DSPGFQEFGLHHLTEGRLERAFPEFRPLLPNCRFYNCHHLQEPGCAILEAVADGRIRRER
HALYAQLVHEASQIVR