Protein Info for BPHYT_RS14630 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 29 to 54 (26 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details PF07690: MFS_1" amino acids 50 to 252 (203 residues), 49.3 bits, see alignment E=1.8e-17 amino acids 242 to 409 (168 residues), 44.7 bits, see alignment E=4.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2950)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5Y0 at UniProt or InterPro

Protein Sequence (418 amino acids)

>BPHYT_RS14630 MFS transporter (Burkholderia phytofirmans PsJN)
MPPSAASTVPAHAPGLRDTDPHDRRAARVLAVCQALYTSSVSIDLTLTGLVGYTLADDKA
LATLPFSLITVAAALTTIFASFLMARIGRRAGFVLGAGVGALGGAISVWAIFHHSFWAFC
AGTSTVGVFQAFAQYYRLAAADAVGIDDKSRAISTVLAGGVVAAVCGPLLAAWSKDWLAP
VAFAGSYALVTGFGLLSIALLTLLYRDAAPTASTAATHEAARPLGEIVRQPIFAAALANN
ALGYAVMMFVMTATPIAAVACGHTIGDGAQVIQWHLVGMFAPSLFSARLIKHFGVLRVIG
AGIALSALCGVLALRSTDLPHFYAALACLGVGWNFMFVGGSTLLAQSYRPSERAKTQATS
EFTTFAFSALGSLFAGQLLARFGWATINAAIFPLLAAAALATLGYAWSRKRRLMAEVS