Protein Info for BPHYT_RS14565 in Burkholderia phytofirmans PsJN

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 56 to 92 (37 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 177 to 204 (28 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details PF03591: AzlC" amino acids 27 to 168 (142 residues), 140.1 bits, see alignment E=3.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2936)

Predicted SEED Role

"FIG006238: AzlC family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5W6 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BPHYT_RS14565 branched-chain amino acid ABC transporter permease (Burkholderia phytofirmans PsJN)
MTHSTAGRPTSPSHFKEFTAGARDIIPMMVGAAPFGVIFGTLVASGPLHLWHGQLMSLVV
FAGSAQFIALGLIAGHASFAVVWATTLVVNLRHVLYSATLAPHVAHLPARWRWVLGALLT
DEVFAVAWEHYRHREPGTVGPHYFFGAGLAMYLNWQLWTAAGLLFGAAFPDLQSLGLDFA
MVATFIAIVVPQLVALRYIAAAVTSGMLAFFWQAWPYKLGLLGAVFAGVAIGVLLSTSRP
NLRGNGKTAEASR