Protein Info for BPHYT_RS14370 in Burkholderia phytofirmans PsJN

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR02191: ribonuclease III" amino acids 2 to 210 (209 residues), 229.4 bits, see alignment E=1.9e-72 PF14622: Ribonucleas_3_3" amino acids 7 to 130 (124 residues), 133.7 bits, see alignment E=6.8e-43 PF00636: Ribonuclease_3" amino acids 26 to 116 (91 residues), 78.7 bits, see alignment E=8e-26 PF00035: dsrm" amino acids 144 to 210 (67 residues), 47.7 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to bpy:Bphyt_2899)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZV5 at UniProt or InterPro

Protein Sequence (409 amino acids)

>BPHYT_RS14370 ribonuclease III (Burkholderia phytofirmans PsJN)
MRYEFRNAELLRQALTHRSHSSTHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVR
ANLVKQQSLYEIAQALNISEGLRLGEGELRSGGFRRPSILADTLEAVLGAVFLDGGFDAA
QTVIKRLYVPILDHIDPRTLGKDAKTLLQEYLQGHKIALPTYTVVATHGAAHNQQFEVEC
TVPKLDVKVSGSGASRRAAEQAAAKKALDEVMAAAPAVVAKPKRSKGARAAKHAELEIVP
GVTGVQAALDLRSPDRKSERGAGRGESRAAAEPATERPALTATAAPLAVIRAAHVEYSGP
DKTERAEKAEKTAAHAGDKSADKVAAEKAAEKLDTKAADAKPAEAKPAESKPEAKPETVA
VRSVDKHRSREATPGPAVPVPVPSAAAAPTEHEPGVADAVQTRVADAGH