Protein Info for BPHYT_RS14285 in Burkholderia phytofirmans PsJN

Annotation: drug:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF00583: Acetyltransf_1" amino acids 60 to 144 (85 residues), 22.8 bits, see alignment E=9.5e-09 PF13673: Acetyltransf_10" amino acids 64 to 162 (99 residues), 46 bits, see alignment E=5.2e-16

Best Hits

Swiss-Prot: 45% identical to ELAA_SHIFL: Protein ElaA (elaA) from Shigella flexneri

KEGG orthology group: K02348, ElaA protein (inferred from 100% identity to bpy:Bphyt_2885)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZU1 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BPHYT_RS14285 drug:proton antiporter (Burkholderia phytofirmans PsJN)
MTEPQQTAAMRLAQLDWRWKSFHDLTGVEVYTMLGARAAVFVVEQNCLYGDIDGLDMDAW
HLLVYGADERRPALAGYLRVLVPDADDTDIRIGRVLTTADFRGIGLGNAMLERSLTHIRA
QWPGTPIRLHAQAHLQGFYGAFGFTPVSEIHEEDGIPHVWMRSA