Protein Info for BPHYT_RS14235 in Burkholderia phytofirmans PsJN

Annotation: multidrug ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 203 (27 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 32 to 306 (275 residues), 59.9 bits, see alignment E=3.3e-20 PF00005: ABC_tran" amino acids 372 to 520 (149 residues), 111.5 bits, see alignment E=5.4e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to bpy:Bphyt_2875)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZT1 at UniProt or InterPro

Protein Sequence (625 amino acids)

>BPHYT_RS14235 multidrug ABC transporter ATPase (Burkholderia phytofirmans PsJN)
MTRKKLDFRGQAFKDVLGFTFHHWAQQPWRIVVITALVLLSAVADVLTPMFAGRLVDAIA
SGAASDAVAWHAAVTAFCVLSALGLGATLLRQGVYFNIIRLTLKMMSEIAANAFHRVQRF
STDWHANSFAGSTVRKITRGMWALDLLNDTLLIALLPSLVMLVGATVLLGWRWPMMGAVV
GIGSVLYIAVTVAMSLGFVAPAARLANAWDTRMGGALADAVSCNGVVKAFGAEEREEALL
ARVIGKWRHRTRRTWMRGTINGGVQGGMLVAIQAAILGAALLLWARGDASVGDITFALTM
FFMLQGYLRDVGMHIRNLQRSVNDMEELVSQESQPLGIEDRPGAVPITIGKGEIRFEHVT
FHYGTNGLPLYDNFSVRIAPGERVGLVGHSGSGKTTFIKLIQRLYDISEGRITIDGQDIA
QVRQASLRSQIAIVQQEPVLFHRSLAENIAYARPGASRAEIERAAKLASAHGFIAALPNG
YDTLVGERGVKLSGGERQRVAIARAFLADAPILILDEATSSLDSESEVLIQQAMERLMTG
RTTLVVAHRLSTVRALDRLLVLDKGKVIEEGSHDALIRLENGLYRRLFERQALELIKGLG
EPEFTTRTARPNANRTDDSSLLVGK