Protein Info for BPHYT_RS14140 in Burkholderia phytofirmans PsJN

Annotation: phosphate transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 126 to 154 (29 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 32 to 325 (294 residues), 299.1 bits, see alignment E=1.4e-93 PF00528: BPD_transp_1" amino acids 110 to 319 (210 residues), 48.9 bits, see alignment E=3.3e-17

Best Hits

Swiss-Prot: 76% identical to PSTC_SHIFL: Phosphate transport system permease protein PstC (pstC) from Shigella flexneri

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to bpy:Bphyt_2857)

MetaCyc: 76% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZR3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BPHYT_RS14140 phosphate transporter permease subunit PstC (Burkholderia phytofirmans PsJN)
MSDIQLAPGASRSTPPGSASQQKAPSRAGDVIFGGLARLAAIITLLLLGGIIVSLIVASM
PSIKQFGLSFLWTADWDPPSKQFGALVPIYGTIATSIIALIIAVPVSFGIALFLTELSPA
WLRRPLGIAIELLAAIPSIVYGMWGLLVFAPIFATYFEKPLGVVLGGIPFVGALFQGAPI
GIGILCAGVILAIMIIPYIASVMRDVFEVTPVLLKESAYGIGCTTWEVMWKIVLPFTKSG
VIGGVMLGLGRALGETMAVTFVIGNTNLLDNVSLFSPGNSITSALANEFAEADPGLHTSA
LMELGLILFVITFIVLAISKVMLLRLQKAEGAK