Protein Info for BPHYT_RS13950 in Burkholderia phytofirmans PsJN

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 224 to 253 (30 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 7 to 256 (250 residues), 90.7 bits, see alignment E=4.6e-30

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_2818)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZM4 at UniProt or InterPro

Protein Sequence (312 amino acids)

>BPHYT_RS13950 branched-chain amino acid ABC transporter permease (Burkholderia phytofirmans PsJN)
MQSFVINLLNGVSYGLLLFMLSAGLTLIFSMLGVLNFAHASFYMLGAYVGFSVAAREGFW
SALVVAPLVVGLIGAALERWLLRRVRVQGHLAELLLTFGAAYLLGELVKLGWGLSPLSAT
VPAVLDGPLFTVYGAAFARYRAFMMAVSLAMLAVLFAVLRVSKAGLIVRAALTHASAVEA
LGHNVPRVFTGVFAAGTALAALAGVIGAPLFVIEPGMAESLGSIVFVVVVIGGLGSLGGA
LAASLLVGCVQTLAVASNVSLGDVLSIFDATLPVEWDALTLAQLAPLIPYLLLVAMLALR
PRGLFGRRDDHA