Protein Info for BPHYT_RS13915 in Burkholderia phytofirmans PsJN

Annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 28 to 640 (613 residues), 905.8 bits, see alignment E=7.5e-277 PF02776: TPP_enzyme_N" amino acids 30 to 157 (128 residues), 67.3 bits, see alignment E=1.7e-22 PF00205: TPP_enzyme_M" amino acids 244 to 376 (133 residues), 115.4 bits, see alignment E=2.5e-37 PF02775: TPP_enzyme_C" amino acids 444 to 598 (155 residues), 116 bits, see alignment E=2e-37

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 100% identity to bpy:Bphyt_2810)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZL6 at UniProt or InterPro

Protein Sequence (657 amino acids)

>BPHYT_RS13915 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (Burkholderia phytofirmans PsJN)
MNQRVVHHEAASANDASHASTRTDGTVRLTTAQALVRYLAAQRVATEDGEGTEPLFGGVF
AIFGHGNVAGIGEALYQHREELPTLRAHNEQAMAHSAIAYAKAHFRRRMMAVTTSIGPGA
TNLVTAAALAHVNRLPVLLLPGDIFVSRAPDPVLQQVEDFHDGGVSANDALKPVSRYFDR
IVHPAQLLNALPRAVRVLTDAALCGPVTLALPQDVQAQAWDFPVDFFKPRVVTFYSPAPR
ADEIEAAIARLRHAKRPLIVAGGGLLYGRATDALHRFATTHGIPVAETQAGKGALAWNDP
LNAGALGVTGSPAANALAHDADCVLAIGTRLQDFTTGSNTLFTQADVIAVNANAFDGLKQ
RAQVVEADARLALEALAEPLQGWHADRAWTARAHKLAASWRDTVSTLTHAPQRDTVLPYE
GDVIGAVQRSSASSPTNDIVVCAAGTLPAELHKLWRAGKPGAYHVEYGYSCMGYEIAGGL
GVKLARPAREVIVMVGDGSYLMMNSEIATSVMIGAKLIVVVLDNRGYGCINRLQQACGGA
PFNNLLENCMQGPLGAPKIDFAAHARALGAQAEHAANVAELAAALQRARAADRTYVISID
TDPAHTTDEGGWWWEVAVPEVSTRPAVRDARAKYETQLAARAEPAGSAQNTGSTDNE