Protein Info for BPHYT_RS13915 in Burkholderia phytofirmans PsJN

Annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase
  • amino acids 28 to 640 (613 residues), 905.8 bits, E=7.5e-277
• PF02776: TPP_enzyme_N
  • amino acids 30 to 157 (128 residues), 67.3 bits, E=1.7e-22
• PF00205: TPP_enzyme_M
  • amino acids 244 to 376 (133 residues), 115.4 bits, E=2.5e-37
• PF02775: TPP_enzyme_C
  • amino acids 444 to 598 (155 residues), 116 bits, E=2e-37

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 100% identity to bpy:Bphyt_2810)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

See B2SZL6 at UniProt or InterPro

Protein Sequence (657 amino acids)

>BPHYT_RS13915 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (Burkholderia phytofirmans PsJN)
MNQRVVHHEAASANDASHASTRTDGTVRLTTAQALVRYLAAQRVATEDGEGTEPLFGGVF
AIFGHGNVAGIGEALYQHREELPTLRAHNEQAMAHSAIAYAKAHFRRRMMAVTTSIGPGA
TNLVTAAALAHVNRLPVLLLPGDIFVSRAPDPVLQQVEDFHDGGVSANDALKPVSRYFDR
IVHPAQLLNALPRAVRVLTDAALCGPVTLALPQDVQAQAWDFPVDFFKPRVVTFYSPAPR
ADEIEAAIARLRHAKRPLIVAGGGLLYGRATDALHRFATTHGIPVAETQAGKGALAWNDP
LNAGALGVTGSPAANALAHDADCVLAIGTRLQDFTTGSNTLFTQADVIAVNANAFDGLKQ
RAQVVEADARLALEALAEPLQGWHADRAWTARAHKLAASWRDTVSTLTHAPQRDTVLPYE
GDVIGAVQRSSASSPTNDIVVCAAGTLPAELHKLWRAGKPGAYHVEYGYSCMGYEIAGGL
GVKLARPAREVIVMVGDGSYLMMNSEIATSVMIGAKLIVVVLDNRGYGCINRLQQACGGA
PFNNLLENCMQGPLGAPKIDFAAHARALGAQAEHAANVAELAAALQRARAADRTYVISID
TDPAHTTDEGGWWWEVAVPEVSTRPAVRDARAKYETQLAARAEPAGSAQNTGSTDNE