Protein Info for BPHYT_RS13900 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 316 to 347 (32 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 74 to 372 (299 residues), 146.7 bits, see alignment E=3.8e-47

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_2807)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZL3 at UniProt or InterPro

Protein Sequence (385 amino acids)

>BPHYT_RS13900 ATPase (Burkholderia phytofirmans PsJN)
MGVAGKHFPPHVKTNTGEAAPSLPDSDERLRKESRFGHVLNRPEFAAISGAVLVFLVFAL
TAGNSGMFNLDGVMNWSQVSAYLGILAVGACLLMIAGEFDLSIGSMIGFSGMMVAIPSVY
FHWPISLAILFAFAGSMLLGALNGYLVMRTRLPSFIVTLAFLFILRGLTLALSIMFADRT
IVSGVGDLAQQDWFANTLFHGVALNGLFTMLARHGIGTMLDNGHALVPGIPKVILWWLGL
AAVCAFVLAKTRAGNWILAVGGDANAAKNVGVPVRRVKISLFVLTAFCSCLFAVLQVCDI
GSAAADRGLQKEFEAIIAAVIGGTLLTGGYGSVVGACFGALIFGVVQIGITYTNVSSDWF
RVFLGVMLLIAVLFNHYVRRRVSQA