Protein Info for BPHYT_RS13745 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details PF09842: DUF2069" amino acids 39 to 136 (98 residues), 108 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2775)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZI1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>BPHYT_RS13745 membrane protein (Burkholderia phytofirmans PsJN)
MNEPHAQPAAASNAHTAMQASTPPTAAPVPRNRAAALGATTALVALIVVSVVWEWWLAPL
RPGGSALVLKAVPLLLALPGVWRQRLYTLQWASMLILLFFAEGIVRGWSERGLSARLGWL
EAALSVVFFVCALAYVAPFKRAAKRAAKQAAKQAATQAATQPANQAGSEPADHANPSG