Protein Info for BPHYT_RS13735 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 244 to 272 (29 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 17 to 272 (256 residues), 225.7 bits, see alignment E=4.5e-71 PF03631: Virul_fac_BrkB" amino acids 24 to 273 (250 residues), 206.1 bits, see alignment E=3.8e-65

Best Hits

Swiss-Prot: 96% identical to Y3061_PARXL: UPF0761 membrane protein Bxeno_A3061 (Bxeno_A3061) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to bpy:Bphyt_2773)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZH9 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BPHYT_RS13735 membrane protein (Burkholderia phytofirmans PsJN)
MSRVRFDLDTLKRLAQFAAQRSSEDRIPQVAGSLTFTTMLSLVPLATVAFALFTAFPIFA
SFQMSLQIFLADHLMPAQLNSQIFNYLNQFASKAKGLTTIGMIFLFVTAVMTMMTVESAF
NVIWRVRKARPIAQRILVYWAIITLGPILIGVSLSISSYLFTQSMTFTAAQRMTPVIEWA
LTGAALPLTAVAFTILYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRIPTYTA
VYGAFAAVPLFLVWMYLCWFITLAGAMIASALPAIRIGQFHRPTFEGSNLFDSLELLARL
SEAREAGKRGYTVPELSRMLRRDMDTTINLLQKLEEIEWIARLQEDGLRPHFLLLANPAQ
ITVERLFEMFVIDRAELEYQLQLASTRVDGEMLLAALENDKLKVTLAALLAARAAARAAR
AEQSEPGTPSMPHQAA