Protein Info for BPHYT_RS13630 in Burkholderia phytofirmans PsJN
Annotation: 50S ribosomal protein L20
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL20_BURA4: 50S ribosomal protein L20 (rplT) from Burkholderia ambifaria (strain MC40-6)
KEGG orthology group: K02887, large subunit ribosomal protein L20 (inferred from 98% identity to bma:BMA1093)MetaCyc: 71% identical to 50S ribosomal subunit protein L20 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L20p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2SZF9 at UniProt or InterPro
Protein Sequence (119 amino acids)
>BPHYT_RS13630 50S ribosomal protein L20 (Burkholderia phytofirmans PsJN) MPRVKRGVTARARHKKIIKLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL WITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKAAFAAIVQQVKAAVAA