Protein Info for BPHYT_RS13510 in Burkholderia phytofirmans PsJN

Annotation: C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 350 to 376 (27 residues), see Phobius details PF00375: SDF" amino acids 10 to 403 (394 residues), 350.8 bits, see alignment E=5.1e-109

Best Hits

Swiss-Prot: 74% identical to DCTA_PARXL: C4-dicarboxylate transport protein (dctA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2729)

MetaCyc: 59% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY44 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BPHYT_RS13510 C4-dicarboxylate transporter (Burkholderia phytofirmans PsJN)
MKRKPLYKVLYVQVIVAIIIGVALGHFLPADAVAMKPLGDAFIKLVRMIISPVIFCTVVT
GIASMHDMRKVGRVGGKALLYFEVVSTLALAIGLLAAHVLKPGIGFNVDPSTLDAGAIAS
YAAQAAHGEGLAGFFMHIIPDTFAGAFTQGDILPVLLIAMLFGTALAVLGEPAKPLIGLI
DLLSKTFFRIVRMITSLAPIGAFGAIAFTIGKYGIVSLLPMMKLIGTFYLTAFLFVSCGL
GLIARACGFSLWRFVVYIKDELLIVLGTSTSEAALPQLMEKLERLGCSRGIVGLVVPTGY
SFNLDGTNIYMTLAVLFLAQATNTHLTIAQEITLLAVTMLTSKGSTGVTGAGFITLAASL
SVVPTVPVTAMVLILGIDRFMSECRALTNTMGNGVASIVIAAWEKELDRGKLNAAL