Protein Info for BPHYT_RS13235 in Burkholderia phytofirmans PsJN

Annotation: lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 135 to 135 (1 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 508 to 528 (21 residues), see Phobius details PF02652: Lactate_perm" amino acids 16 to 521 (506 residues), 450.7 bits, see alignment E=4e-139 TIGR00795: transporter, lactate permease (LctP) family" amino acids 16 to 522 (507 residues), 430.1 bits, see alignment E=7e-133

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to bpy:Bphyt_2673)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXY9 at UniProt or InterPro

Protein Sequence (532 amino acids)

>BPHYT_RS13235 lactate permease (Burkholderia phytofirmans PsJN)
MFHQLLTPVGNSLLPSFLVAALPIIVVLLLLGWARRPAWQASLAGLVVGLIVAIFVWQFP
VGLAVDSVVAGAVFACWPVMWIVFAAILLYNISQRSGRFAAFRMWMIDNLPNDRRVVLVV
IGFSFGALLEGISGFGTPVAITSSLLILLGFPTLEALTFTLIFNTAPVAFGALGVPITVL
GAVTHLPADSLAKMVGRQLPFFAFLLPFYVIGVYAGFRNMLRVWPVLLVSGASFALTQFV
ASNYVNYSLTDVLSSMVSLILTIAFLRVWKPAADPKFAVNIDRVGEVRGKIGGAQGWYPW
IIVSVVVIIWTVAKIFLIGDVKVPWPGLDKAVFITLYNTPYSAVWDFQPLATGTAILVAA
LITAAVVKLSPREFGAAVADTWVQTRIAILTVATIVGLAYLMNYSGLTYTLGLGASSVGP
FFPLVSAFLGWVAVFLSGSDTSGNALFGNLQVVAANQLNLNPILMAAANSSGGVMGKMIS
PQNISTGVATTELKGKEGVVFAKTFKHSILLTVLLGVLVWLQQNFLQWMIPH