Protein Info for BPHYT_RS12845 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 318 to 443 (126 residues), 92.4 bits, see alignment E=1.2e-30 PF13188: PAS_8" amino acids 320 to 361 (42 residues), 32.1 bits, see alignment 3.2e-11 PF00989: PAS" amino acids 322 to 433 (112 residues), 66.4 bits, see alignment E=9.3e-22 PF08448: PAS_4" amino acids 334 to 438 (105 residues), 51.4 bits, see alignment E=4.8e-17 PF13426: PAS_9" amino acids 335 to 435 (101 residues), 55.3 bits, see alignment E=2.8e-18 PF08447: PAS_3" amino acids 343 to 427 (85 residues), 32.7 bits, see alignment E=3.1e-11 PF00512: HisKA" amino acids 589 to 656 (68 residues), 28 bits, see alignment E=7.3e-10 PF02518: HATPase_c" amino acids 701 to 815 (115 residues), 71.6 bits, see alignment E=3e-23 PF14501: HATPase_c_5" amino acids 705 to 795 (91 residues), 25.3 bits, see alignment E=5e-09

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to bpy:Bphyt_2592)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5N5 at UniProt or InterPro

Protein Sequence (838 amino acids)

>BPHYT_RS12845 ATPase (Burkholderia phytofirmans PsJN)
MLTERLFARSARTAGSPADSTPSSRWHHGPWWSNSYLLTPLLSILVFLVVMSLILWSLNR
REQQQQEDTLYRNVAWAQQQIRLSMTGAQEQIQALARDLVAGRADPHSFQVSTTDIMQGH
PEILYMNWYTSAQQPRWPNTALPVFGQRLAKPNDAQMDEAVKAAFTEARNTRRQVYSPLI
YDDVGNGYITLQTPVFRDRDFLGTIAAVFSVEGILKHDIPPELSAKYKISIIDVNNRELT
TTSTRPRLPRDMFYDLPLDPPGQGVSVRVYAFPQMTNFTNNTLVWLVAGLSCFVLWSLWS
LWKHTRQRFEAQQALYAEAFFRRAMENSVLIGMRVLDMHGRITHVNPAFCRMTGWDESDL
VGKNAPFAYWPRDAYPEMQRQLDMTLRGKAPSSGFELRVRRKDGSLFHARLYVSPLIDSS
GRQTGWMSSMTDITEPKRAREELAAAHERFTTVLESLDAAVSVLAADEAELLFANRYYRH
LFGIRPDGHLELAGGGFDSAQASSDSIDMVDTYAGLPAAALTESTADAQEIYVQSIQKWF
EVRRQYIQWVDGHLAQMQIATDITTRKQAQELSRQQDEKLQFTSRLMTMGEMASSLAHEL
NQPLAAINNYCSGTVALVKSGRTTPDNLLPVLEKTAQQAVRAGMIIKRIREFVKRSEPKR
QATRVADIVADAVGLAEIEARKRRIRIVTDLRSRLPVIYVDPVLIEQVLVNLLKNAAEAM
AEARPNAVDPVIRVVVRLESGFVCFSVVDQGPGVDEATAERLFEPFYSTKSDGMGMGLNI
CRSIIESHRGRLWVVNNVESDGHITGATFHCSLPIGEPDGPSNGGTQAPTPQTVTGEL