Protein Info for BPHYT_RS12810 in Burkholderia phytofirmans PsJN

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02754: CCG" amino acids 3 to 84 (82 residues), 57.2 bits, see alignment E=7.7e-20 amino acids 132 to 215 (84 residues), 43.5 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 48% identical to LUTA_GEOKA: Lactate utilization protein A (lutA) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2585)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5M8 at UniProt or InterPro

Protein Sequence (240 amino acids)

>BPHYT_RS12810 Fe-S oxidoreductase (Burkholderia phytofirmans PsJN)
MRVGLFVTCLIDLMRPEIGFSVIKLTEGAGFEVMVPPAQTCCGQPAYNSGERRIARDLAE
KTLREFEQFDYVVVPSGSCGGMIRAHYGDLFADDPELMNRFGRLRAKVFELTDFLVNVAK
VQLQPGEFAGQVTYHDSCSGLRELGVKAQPRALLAQVGVTVNEMKDCEHCCGFGGTFAVK
YGDISTAIVDEKCANIRASGTGAVVLGDLGCMLNIEGRLRRTGDATTRVLHIAQVLAGDV