Protein Info for BPHYT_RS12315 in Burkholderia phytofirmans PsJN
Annotation: ribonuclease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RRAAH_PARPJ: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Bphyt_2492) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 100% identity to bpy:Bphyt_2492)Predicted SEED Role
"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2SXN2 at UniProt or InterPro
Protein Sequence (164 amino acids)
>BPHYT_RS12315 ribonuclease (Burkholderia phytofirmans PsJN) MSFATADLCDAHEDQLALGTLRVLEPVFHLFSRAECFSGEAVTLKVFEDNALVRATLEEK GAGRVLVIDGGGSLRCALVGGNLAQLAEQNGWAGIVLNGCVRDALELNEVNVGIAALTTS PRRGQKLGTGERDVAVHLPGALVRPGEWVYADIDGVLVASAALN