Protein Info for BPHYT_RS12300 in Burkholderia phytofirmans PsJN

Annotation: haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR01428: haloacid dehalogenase, type II" amino acids 10 to 226 (217 residues), 220.1 bits, see alignment E=2.9e-69 PF00702: Hydrolase" amino acids 10 to 213 (204 residues), 73.3 bits, see alignment E=3.7e-24 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 11 to 118 (108 residues), 39.2 bits, see alignment E=8.7e-14 amino acids 139 to 211 (73 residues), 61.9 bits, see alignment E=8.7e-21 PF13419: HAD_2" amino acids 139 to 218 (80 residues), 30.2 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 100% identity to bpy:Bphyt_2489)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 3.8.1.2

Use Curated BLAST to search for 3.1.3.- or 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXM9 at UniProt or InterPro

Protein Sequence (271 amino acids)

>BPHYT_RS12300 haloacid dehalogenase (Burkholderia phytofirmans PsJN)
MSATTTLSPKAVIFDAYGTLFDVHSVIAAAEQMFPGHGDALSQLWRQKQIEYTQLRTLAD
SADAAGAHYRPFWDITLDALRFAAKKLQLSLGRAAEKRLMDEYACLSAFPDAVPALRQLR
EAAPDPAARAGGESAPRPRLAILSNGNPQMLDIAVKSAGMTRLFDRVLSVDTVRAYKPSP
AAYALGTQAFDAQPREIVFVSSNGWDVAGATWFGFTTFWLNRQNAPAEELGVTPHGVGGG
MADLLAFLKNPASSGRSSGAGGSRTRHSPGA