Protein Info for BPHYT_RS12265 in Burkholderia phytofirmans PsJN

Annotation: alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 18 to 151 (134 residues), 115 bits, see alignment E=1.4e-37 PF00583: Acetyltransf_1" amino acids 22 to 128 (107 residues), 58 bits, see alignment E=2.9e-19 PF13302: Acetyltransf_3" amino acids 28 to 128 (101 residues), 27.9 bits, see alignment E=8.5e-10 PF08445: FR47" amino acids 48 to 131 (84 residues), 30.5 bits, see alignment E=7.5e-11 PF13508: Acetyltransf_7" amino acids 50 to 129 (80 residues), 45.7 bits, see alignment E=1.7e-15 PF13673: Acetyltransf_10" amino acids 52 to 134 (83 residues), 35.3 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 99% identity to bxe:Bxe_A1655)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5F2 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BPHYT_RS12265 alanine acetyltransferase (Burkholderia phytofirmans PsJN)
MSGVLLADRYMSPMTEGDLDEVAAIEKIAYEFPWSRGNFGDSLRNGYFGVCLRHVTGTLI
GYCVLMPVVDEMHLLNLCVTPAAQGAGAGLALLREAVRITRAEKLEGLLLEVRPSNHRAI
RLYERFGFASIGRRKNYYPARHRSREDAIVMRFSFATEGADGAA