Protein Info for BPHYT_RS12180 in Burkholderia phytofirmans PsJN

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00892: EamA" amino acids 10 to 138 (129 residues), 30 bits, see alignment E=2.7e-11 amino acids 158 to 290 (133 residues), 44.2 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2464)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5K3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BPHYT_RS12180 multidrug DMT transporter permease (Burkholderia phytofirmans PsJN)
MSNWLRNGWPTLAIMLGASVWGMIWYPLRMLNALGVTGTAASALTSGAGCLFVLLVRYRA
LKTVRWHWLLPALALAAGITNLGFVWGSIHGQVMRVLLLFYLTPAWTALFAHFILHERLT
WAGAALAALSLAGAMTMLWSPQLGIPVPGNLAEWAGLAGGMGFAMSNVLILKTSRVLPNM
KPEMRTATIFGGAALFSACASLFEAMPAPPTGAHLGTAVWLVLGLGFLLASNNMLVQYGL
ARVPANRASIIMLFEIVVTALSAWLFAGETPGPREWAGGVCIVLASALSSWVHRTKAMPP
DPAIQEASLADQRDTGLDDRKDGKNRPRAMV