Protein Info for BPHYT_RS12115 in Burkholderia phytofirmans PsJN

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 272 (270 residues), 202 bits, see alignment E=1.6e-63 PF01864: CarS-like" amino acids 168 to 245 (78 residues), 22.8 bits, see alignment E=8e-09

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to bpy:Bphyt_2450)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5I9 at UniProt or InterPro

Protein Sequence (273 amino acids)

>BPHYT_RS12115 phosphatidate cytidylyltransferase (Burkholderia phytofirmans PsJN)
MLKTRVITAIILLAVFLPVTLFAPVGAFGALIAFVVVFAAWEWARLLKLGGAGPVIYALI
AAVALVASTRLGTGIEQARPLFEAAAIFWGIAGPFVLLRKPALAQGVWRPFLFLAGIVVF
VACWHALVAARMQGVPFVLSLLLLVWLADIGAYFSGKAFGKHKLAPAISPGKTWEGAIGG
WLVVMIVAAAAVFLHAFEPTLYSALLAHWGAVRTLLALTLLVAFSVVGDLFESMMKRQAG
VKDSSGLLPGHGGVLDRIDALLPVLPLAMLLLG