Protein Info for BPHYT_RS11875 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 189 to 211 (23 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 41 to 176 (136 residues), 66.1 bits, see alignment E=6.8e-22 PF07695: 7TMR-DISM_7TM" amino acids 190 to 367 (178 residues), 57 bits, see alignment E=5.4e-19 PF00512: HisKA" amino acids 449 to 508 (60 residues), 31.9 bits, see alignment 2.2e-11 PF02518: HATPase_c" amino acids 558 to 664 (107 residues), 84.6 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2398)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5D4 at UniProt or InterPro

Protein Sequence (773 amino acids)

>BPHYT_RS11875 histidine kinase (Burkholderia phytofirmans PsJN)
MTTTRWLRLLFLCLSWWTTHASAIGLDTSGARTQEAPTVDQLQVFEDVSGKMNLDDILTL
SAGSAPGFRPMQRSRLTPGFTRSAWWLRMSVSNSGSTALPLVLVFPDARFLTVDFYTGSR
SGNHWTHAGIDPARSVPQSLPARYRLVNFSLVPGEQRLFLIRAASDTALTLEPKLYPAAV
YDALEMRAALWDGGLIGGTLALAWCALLIAYFSHSVSFLVLAALCAMTALFEAADRGYTK
IYLWPFATGWSARSVTVLGCTAVLLFIVFILRISRSEKANLPARYILFGFALLECVAAIG
AAFGNLFVFAQVGVYINALFGVFTVIIAAHLARQSTPTARIMLLVMSFSLFSFALRMLET
LGSLPTALAWLKSDIHPNPVVAVTGLATNLIVLAAWINHVGKQRLAARTALADWQRTEHD
RLREQVAQRTVELNEALLYAEEKNQQLIETLGYVSHDLRAPLATITGYARQLRELADSKQ
VKPILAIERSVNYQLGLIDELVGYAKTELQPLEIAPVATDLPALLDDIAEYALALCSQLN
NQFNYQALTPLPRRLTIDGRRLQQVLLNLLSNASKFTRDGFVTMTVSTRLQDGQWHMRFE
VADTGIGIDIEAQSRLFAAFRRIQAVNGSTGLGLIIAQRIVNSMGGDLRVSSAPHRGTSF
TFELIVPSAADENALPSSIVEHSSGCSVPIRSQRKHGFAVAVPPESDRRELAVLAKNGRL
TDIERWIDSMTNAHPACVAFLTDMRHCLEALDFPAIEARALAPHKKYEGSRAC