Protein Info for BPHYT_RS11865 in Burkholderia phytofirmans PsJN

Annotation: adhesin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF05658: YadA_head" amino acids 130 to 156 (27 residues), 27.1 bits, see alignment (E = 6.2e-10) amino acids 162 to 184 (23 residues), 17.8 bits, see alignment (E = 5e-07) amino acids 186 to 208 (23 residues), 12.5 bits, see alignment (E = 2.4e-05) amino acids 198 to 220 (23 residues), 14.3 bits, see alignment (E = 6.4e-06) amino acids 225 to 251 (27 residues), 17.2 bits, see alignment (E = 8e-07) amino acids 239 to 263 (25 residues), 11.4 bits, see alignment (E = 5.4e-05) amino acids 253 to 279 (27 residues), 17.3 bits, see alignment (E = 7.2e-07) amino acids 267 to 293 (27 residues), 17.1 bits, see alignment (E = 8.8e-07) amino acids 281 to 306 (26 residues), 14.4 bits, see alignment (E = 6e-06) amino acids 299 to 319 (21 residues), 15.5 bits, see alignment (E = 2.8e-06) amino acids 323 to 349 (27 residues), 22.6 bits, see alignment (E = 1.5e-08) amino acids 473 to 498 (26 residues), 21.8 bits, see alignment (E = 2.8e-08) amino acids 501 to 526 (26 residues), 35.5 bits, see alignment (E = 1.4e-12) amino acids 519 to 538 (20 residues), 15.8 bits, see alignment (E = 2.2e-06) PF05662: YadA_stalk" amino acids 389 to 432 (44 residues), 41.9 bits, see alignment 1.6e-14 amino acids 544 to 582 (39 residues), 43.9 bits, see alignment 4e-15 PF03895: YadA_anchor" amino acids 595 to 655 (61 residues), 47.2 bits, see alignment 2.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2396)

Predicted SEED Role

"Autotransporter adhesin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5D2 at UniProt or InterPro

Protein Sequence (655 amino acids)

>BPHYT_RS11865 adhesin (Burkholderia phytofirmans PsJN)
MNKSRNKLVWNRQVGALVAAAGTQRGVRGDDGQAEMSKIGIPLKSKAALAALTAVILLPV
GQAYADNLAVGGENAGQTATVGGATAPPASTGGVFPAVAGADGSSQNTAVGINVSAQGGA
ATAVGDTVTANGTNATAVGANSVANGTRAVAIGGGATTTTGDATAIGALAHTTSEFSTAV
GTNSSAAGGTALGFQASANASDATAVGVDSVASGIGSVAIARAQATGQNAIAIGESSAAS
NVAAVAVGAGANASSNSATAIGPLATASGGSSTALGNSSVASGGSAIAIGQSSTSSSLTS
IAVGFNANAASANAIALGTLTQATGANSIAIGNAAVASTAESTALGSGAVTRAATNVSSV
TLNGVTFGGFAGAAPTGVVSIGAVGQEHQLQNVAAGRISATSTDAVNGSQLFSIASQVSA
LSTNLASITVTVDKISTSGSNGTATDDTGTAVGKNSVVSVPNGTAVGNGANVSGQDGTAI
GTNTTVTAARATAIGANSRVTGTDSTAIGTNSQATANNSVALGANSVADRDNTVSVGAPG
AERQITNVADGTAPTDAVNVRQMNDAINSVRDDVQKYRRDANAGTASAIAMANLPQAVLP
GEKVVALAGGNYGGQSAMAVGLSVATQKWMVKGSVTTGVSGHGSVGAGAGVGYRW