Protein Info for BPHYT_RS11710 in Burkholderia phytofirmans PsJN

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 323 to 478 (156 residues), 117 bits, see alignment E=3.6e-38 PF00990: GGDEF" amino acids 327 to 478 (152 residues), 126 bits, see alignment E=6.2e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2363)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5A0 at UniProt or InterPro

Protein Sequence (493 amino acids)

>BPHYT_RS11710 diguanylate cyclase (Burkholderia phytofirmans PsJN)
MDRTIYATKSTRSSRHALVLVPALTVLVLGILWVTILLRLQVEKASVMRDTRVAARTLAD
ALETHTLKTVHDVDEIALLVKYGYERTPQSFDLAAYRAYGLITADTALQVTIAGADGRVI
TSTLPFTGTVDLKDREHFRVHLSPENIGLFISQPVIGRISRQWSIQATRRIDRPDGSFGG
VVIVSEDPAYLTDGFYNSAALGERGMIAVLSGRGFMLSRRAGNSPSRSGEALPSSYVPLG
KTGLADFVDPIDHIERVVASRHLEKYGLTVVAGLSVDEALDDYFRMRRVYVTMASTITLM
LAALSAWITALIVKLLNGKEELRRLSQTDRLTDLPNRGKIVDLLEEAIAAPGAVGKVAVV
FVDLDNFKALNDTYGHQCGDEVLALVAARLHTTVQERGVVGRLGGDEFLVVLEVHAITGV
VGQMVVELTAALQAPLISRWGVEAVGASFGMAILEAGEDSKELIRKADFAMYQAKNRDHA
CRIDSKTDRILAG