Protein Info for BPHYT_RS11580 in Burkholderia phytofirmans PsJN

Annotation: CMP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 1 to 94 (94 residues), 97.4 bits, E=4.3e-32
• PF14437: MafB19-deam
  • amino acids 2 to 142 (141 residues), 122.7 bits, E=1.1e-39

Best Hits

Swiss-Prot: 53% identical to TADA_SALTY: tRNA-specific adenosine deaminase (tadA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2334)

MetaCyc: 52% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

See B2T572 at UniProt or InterPro

Protein Sequence (171 amino acids)

>BPHYT_RS11580 CMP deaminase (Burkholderia phytofirmans PsJN)
MALAQAAAEEARAAGEVPVGAVLVRGEEVIATGFNHPIGGHDPSAHAEMAALRAAAQAVE
NYRLPGCELYVTLEPCLMCAGAIMHARIARVVFGARDPKTGACGSVVDAFANPQLNHHTT
VIGGVLENECGAALKSFFAERRRASREARAAARADVAGAPGSIEPGPAESL