Protein Info for BPHYT_RS11565 in Burkholderia phytofirmans PsJN

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 51 to 76 (26 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details amino acids 475 to 492 (18 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 45 to 480 (436 residues), 298.2 bits, see alignment E=5.2e-93

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to bpy:Bphyt_2331)

Predicted SEED Role

"Hydantoin permease" in subsystem Hydantoin metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T569 at UniProt or InterPro

Protein Sequence (493 amino acids)

>BPHYT_RS11565 nitrate reductase (Burkholderia phytofirmans PsJN)
MAQFSAAPGNPAIPTYADDHASSEPSMPAGYSDRLYNEDLAPLRHQTWGAYNIFAFWMSD
VHSVGGYVFAGSLFALGLTSWQVLIALLVGITIVNLLCNLIAKPSQANGVPYPVACRATF
GVLGANIPAVIRGLIAVAWYGIQTYLASSALVIVVLKFVPQLLPYADVHHHGFLGLSTLG
WTGFMLLWVLQALVFWHGMETIKKFIDFAGPAVYLVMFILAGYMVYRAGWRNIGINLGGV
KYHGMQVVPVMITAISLVVSYFSGPMLNFGDFSRYGKSFRSVQRGNFWGLPVNFLAFSLV
TVITTAATLPVFGELITDPVETVGRIDYPTAVILGALTFTIATIGINIVANFVSPAFDFS
NVAPRLISWRMGGMLAAVASIFITPWNLFNNPAVIHYTLDVLGSFIGPLYGVLIVDYFLV
KRQKIVLDDLYTVSPTGAYWYRNGVNYRAVAALLPAAVIAVGCVMVPALDGMANFSWFIG
AGLAALFYRVLAR