Protein Info for BPHYT_RS11535 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF06181: Urate_ox_N" amino acids 4 to 298 (295 residues), 452.7 bits, see alignment E=3.2e-140

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2325)

Predicted SEED Role

"conserved hypothetical membrane protein, paralogue of Y20848"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T563 at UniProt or InterPro

Protein Sequence (397 amino acids)

>BPHYT_RS11535 membrane protein (Burkholderia phytofirmans PsJN)
MEGFITDWLNLAIRWFHVIAAIAWIGESFYFVALDNSLKPPTDPNQRRRGVFGELWHVHG
GGFYNMQKYTVAPPEMPDDLHWSKWPSYTTWLSGFGLFTVLYLFSPSTYLIDKNVLDMGP
VVAVASALGFLAAGWIVYDSLCRILGNKDKVLGICVGVYVLIAAWLACHIFAGRAAYLIM
GAMLATIMSANVFFVIIPGQRKMVDAMLKGETPNPIYGKRGKQRSVHNTYFTLPVVFAML
SNHYAMTYTHPYNWAVLLVIMLAGALIRQFFVMRHRGQVLWYLPLVGIALMFGALFWTMP
KPVVPQAQAANAPVVRVADIAPVLQQRCVACHSAHPTMMGSAPAGVLLDTPDEISQNAQR
IYQQAVTLKAMPLGNVTHMTDDERMKIAAWFQGGAVK