Protein Info for BPHYT_RS11315 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 102 to 102 (1 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details TIGR00698: conserved hypothetical protein" amino acids 24 to 362 (339 residues), 233.9 bits, see alignment E=1.4e-73 PF03601: Cons_hypoth698" amino acids 24 to 341 (318 residues), 280.1 bits, see alignment E=9.2e-88

Best Hits

Swiss-Prot: 62% identical to Y3732_BORPA: UPF0324 membrane protein BPP3732 (BPP3732) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2281)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T515 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BPHYT_RS11315 membrane protein (Burkholderia phytofirmans PsJN)
MSTAHLTAASTPHAGSSTRGQLNGVLFVALFAAAVTRIAAIPAIAGLGLSPLIVGIVAGA
IYGNALRDGMPASWAAGVNFSARKLLRIAVAFFGLRVSLQEIAQVGVPGLAESVLIVVST
LVIGTWAGMKIMKLDRDTALLTAAGSAICGAAAVLAFESTLQSKPHKSAMAVGSVVLFGT
LSMFLYPVLFKAGWLHLDTVGAGLFFGGTIHEVAQVVGAASNVSPEATHIATIVKMTRVM
LLVPVLLVVGMWVNRSARRDSAAAGAQDGAHGSAPRKLAIPWFALGFLAFVVINSLHVLP
EAATSTLNTLDTFALTMAMTALGIETRIAQIRQAGPRALTTGFILYVWLIAGGLGITWTV
QHLFG