Protein Info for BPHYT_RS11010 in Burkholderia phytofirmans PsJN

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 145 to 179 (35 residues), see Phobius details PF02417: Chromate_transp" amino acids 12 to 175 (164 residues), 123.1 bits, see alignment E=6e-40

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to bpy:Bphyt_2220)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4V9 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BPHYT_RS11010 chromate transporter (Burkholderia phytofirmans PsJN)
MSGRKPGDVTLLEILLLFARVGLTSFGGGLSAWIYREVVTQRGWLEEDEFLGALTLGQIL
PGSNVINLSIYVGYRMKGAIGSTVAVSALLVPPMVVIVLLATVFHQYAQLAWLHEFLEGV
AAAAIGMTASVGFRTARSLLTAQRWPLAMIVVVFVAVGVLRWPLVPVAIVTGAAGLYVAW
RSRQGAR