Protein Info for BPHYT_RS10985 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 258 (240 residues), 138.4 bits, see alignment E=1.5e-44 amino acids 247 to 416 (170 residues), 51.1 bits, see alignment E=5.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2215)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4V4 at UniProt or InterPro

Protein Sequence (432 amino acids)

>BPHYT_RS10985 MFS transporter (Burkholderia phytofirmans PsJN)
MESVKPVAPQRWWYLMPIIFITYSLAYLDRANYGFAAAAGIDRDLGITHGTSSLIGSLFF
LGYCLFQVPGAIYAQRNSVKKLIFFSLILWGLCAAATGMVSNIPMLMMLRFVLGVVEAAV
MPSMLMYISRWFTRSERSRANTFLILGNPVTVLWMSVVSGYLVRSFGWREMFVFEGAPAL
IWAVVWWFTVKDRPADAPWMSAAEKTELDARLKAEQAHIAPVRDYKAAFRSSIVLKFCAI
HALWSIGVYGFIMWLPSILKAASTIDIVSVGWLAAVPYLAAIILMLLASWLSDKTRNRKL
FVWPLLLVGTIAFVASYLIGGSHFWISFALLVVAGATMYAPYGPFFALVPELIPGNVLGG
AIGLINACGALGAFAGSWVVGYLNGVTGSPAASYIFMAGGLLSSVILMITVPANSDEHAK
RGAALPLHRTQH