Protein Info for BPHYT_RS10935 in Burkholderia phytofirmans PsJN

Annotation: 2-keto-3-deoxygluconate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details TIGR00793: 2-keto-3-deoxygluconate transporter" amino acids 1 to 312 (312 residues), 497.1 bits, see alignment E=1.2e-153 PF03812: KdgT" amino acids 4 to 312 (309 residues), 375 bits, see alignment E=1.7e-116

Best Hits

Swiss-Prot: 71% identical to KDGT_ECOL5: 2-keto-3-deoxygluconate permease (kdgT) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K02526, 2-keto-3-deoxygluconate permease (inferred from 100% identity to bpy:Bphyt_2205)

MetaCyc: 71% identical to 2-dehydro-3-deoxy-D-gluconate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-113

Predicted SEED Role

"2-keto-3-deoxygluconate permease (KDG permease)" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4U4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BPHYT_RS10935 2-keto-3-deoxygluconate permease (Burkholderia phytofirmans PsJN)
MKLKKAIDRIPGGLMLVPLLLGACVHTFAPGAGKYFGSFTNGLISGTVPILAVWFFCMGA
TIDLRATGTVLRKSGTLLVTKMLVAWIATIVASHFIPIDGVKAGLFAGLSVLAITTSMDM
TNGGLYAAVMQQYGTKEEAGAFVLMSVESGPLVSMIILGATGVAFFEPRLFVGAVLPFLV
GFTLGNLDGELREFFGRCVHPLIPFFGFALGNGIDLGVIVKSGLPGIVLGLGVIVVTGIP
LIFADRWIAGGNGAAGLAASSTAGAAVANPAIIGEMIPSFKPLVPAATAMVATACLVTAI
LVPILTAMWVRRHHARDALREEFAAGAAGSAPPLNERDVHV