Protein Info for BPHYT_RS10760 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 122 to 122 (1 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 28 to 217 (190 residues), 61.1 bits, see alignment E=9.9e-21 amino acids 239 to 433 (195 residues), 38.2 bits, see alignment E=8.4e-14 PF07690: MFS_1" amino acids 38 to 301 (264 residues), 62.4 bits, see alignment E=3.7e-21 amino acids 293 to 433 (141 residues), 40.9 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2169)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4Q9 at UniProt or InterPro

Protein Sequence (440 amino acids)

>BPHYT_RS10760 major facilitator transporter (Burkholderia phytofirmans PsJN)
MKSPSLSSSLHDVSHGTTRGASTRGLIVATTIGNAFEFFDLTVYSFFAVLLGKLFFPLAS
SQQQLLLSVGTFGIGFVARPLGGVLFGVLADRFGRIAAMNLTLVTMAVGTGLIGVMPTYA
QIGIAAPLAIVAARLLQGFSAGGEVGVATTLLAERASTGRRGFITSWQFASQGAAALAGS
LVGFLLSHYLDKASLEAWGWRIPFLAGILIAPLGLYLRSRLGAEGDKSDAPADAARDSAG
VLKTVMTRDWRLVLVAFLLVIGGTSAHFIVIYYMSTYAIKVLHLPMDVALWCGILAGAVM
LVMSPVGGIWSDMYGRKRVTFISRLLLTLLILPGFYLIEHAPSVSTLYLVVCGLAALHSI
NAGANGTLLPEMFPRSTRATGLSIAYAAGVSIFGGFAQFIVTWLIQSTGNPAAPAWYVIA
CGVLSLIALLFVVDRTRQDI