Protein Info for BPHYT_RS10615 in Burkholderia phytofirmans PsJN

Annotation: phosphonoacetaldehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00702: Hydrolase" amino acids 4 to 195 (192 residues), 47 bits, see alignment E=4.1e-16 TIGR01422: phosphonoacetaldehyde hydrolase" amino acids 4 to 254 (251 residues), 319.6 bits, see alignment E=1.3e-99 PF13419: HAD_2" amino acids 7 to 201 (195 residues), 29.9 bits, see alignment E=5.8e-11

Best Hits

Swiss-Prot: 100% identical to PHNX_PARPJ: Phosphonoacetaldehyde hydrolase (phnX) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 100% identity to bpy:Bphyt_2141)

MetaCyc: 40% identical to phosphonoacetaldehyde hydrolase subunit (Pseudomonas aeruginosa)
Phosphonoacetaldehyde hydrolase. [EC: 3.11.1.1]

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4N1 at UniProt or InterPro

Protein Sequence (267 amino acids)

>BPHYT_RS10615 phosphonoacetaldehyde hydrolase (Burkholderia phytofirmans PsJN)
MKHVKAVIFDWAGTVVDYGSLAPMGAFVETFEQFGVSITIDEARGPMGMAKRPHIAALMA
LPRVAQAWADKYGHAPGEADIDAVYDVFVPKNIAVAASYSSVIPGVADVASALRSDDIRI
GTTTGYTREIMAEIVPGAAAQGFSPDSIVCTGDTPEGRPSPYMIYKTLPELGVWRAKDAI
KVDDTEVGIEEGINGGTWAVGVAVSGNAFGMAENDVKALAPHEFAWRRKAATEKLKAAGA
HYVIDSVADLMPVVYDIEARLARGERP