Protein Info for BPHYT_RS10050 in Burkholderia phytofirmans PsJN

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 46 to 232 (187 residues), 174.1 bits, E=4.8e-55
• PF08659: KR
  • amino acids 49 to 226 (178 residues), 46.5 bits, E=8e-16
• PF13561: adh_short_C2
  • amino acids 54 to 284 (231 residues), 212.7 bits, E=1.2e-66

Best Hits

Swiss-Prot: 52% identical to YHDF_BACSU: Uncharacterized oxidoreductase YhdF (yhdF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to bpy:Bphyt_2025)

MetaCyc: 50% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See B2T4C1 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BPHYT_RS10050 oxidoreductase (Burkholderia phytofirmans PsJN)
MTDTQRPTPPFQNQQQDQTPGQTAPMKPQPDHGEKSYKGSGRLAGKAAIITGGDSGIGRA
VAIAFAREGADVLISYLNEDDDARETARWVEDAGRKALLLRGDITNPAHCKEIVERAFEA
FGRLDVLVNNAAYQMSYPSLEDISDEEWDKTFDTNIGAMFRITRAAVKYMKPGASIVNTS
SINADHPNPGLIAYATTKGAIQNFTGGLAQLLAEKGIRANCVAPGPIWTPLIPSTMPPEK
VEKFGEQVPMKRPGQPAELAAAYVMLASDEASYISGATIAVTGGAPII