Protein Info for BPHYT_RS09920 in Burkholderia phytofirmans PsJN

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 231 to 256 (26 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details PF13520: AA_permease_2" amino acids 8 to 429 (422 residues), 90.1 bits, see alignment E=1.6e-29 PF00324: AA_permease" amino acids 14 to 459 (446 residues), 88.5 bits, see alignment E=4.2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1999)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T491 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BPHYT_RS09920 amino acid permease (Burkholderia phytofirmans PsJN)
MELKGNTLGLWQIVFLVISAAAPLTGMLGAVPPAISLGNGAGIPGAFVIAGVVLLIFSVG
FASMSRHVVRAGAFYAYITAGLGRPLGMAGALVALMSYTFIQIALYGLFGFFCTVILSPL
LHTALPWYGYSLICVAVVQFTGIRGIDLNSRLLGVLMCLELGILLVLAIAIVVHGGGPNG
LTLAPFTPQHVFSGHLGIAVMFAFASFIGFEATAIYGKECRDPKVTVPRATYVSVMLILV
FFAFVTWTIVCAYGLADVVTVATKQPGDFWFIQSAKYLGNAVTTVMSLLLLSSIFASLLS
FHNTLVRYIHALSLEGILPQVLNRVHEKYRSPYVASYLQTFSVCVLLGLFIAAGSDVFNI
VFSWSSALGTIGIVMLQAVTSFSVIAFFRKTRKDTRVWHSFVAPLVGGLGLLYIGVILVR
NLDALSGSDSPIVKSFPWIVFTVALVGVLIGLILRKKRPDIYARFGQ