Protein Info for BPHYT_RS09880 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details PF07690: MFS_1" amino acids 54 to 387 (334 residues), 83 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1991)

Predicted SEED Role

"FIG00460430: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T487 at UniProt or InterPro

Protein Sequence (440 amino acids)

>BPHYT_RS09880 MFS transporter (Burkholderia phytofirmans PsJN)
MSSQPVRTDASLALRDEEAALQNSKTQRYIQLVLLVIAAGAIYPILYLRQVYQPTMLEVF
HITDSQLGYLYSSLGTIFLLSYLPSGWLADRIAPRLLICFSLIATGVLGLWYSTAPSFPM
LMMIFGGWGLSTGLTFWAAVIKRVTMIAGAHEQGRFFGLLDGGRGLIEAMLATIAITLFA
WVTQTKGEPVAAGFKLVVYMYAFLCIALGVVLALVKDPQGTEDAAANRAARQRNNVLTDL
KTLAKIPELWLVAAIVFCGYQVFWATYSFSAYLHEGEIGLTVVMAGTITTLKLWMRPIGG
IGGGFLGDRYSKVSVLVIALFLAALSLLGLMAAPRISSHVLLVFLVLFIGILTYAIRGLY
WSLLDRCNIPAATMGLAIGLISVLGYSPDVFLPLINGYLTQTFPGVFGYQLYFGYVAVMA
ALGGFAGLALRNMLNRKEVA