Protein Info for BPHYT_RS09545 in Burkholderia phytofirmans PsJN

Annotation: peptide methionine sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00357: methionine-R-sulfoxide reductase" amino acids 16 to 139 (124 residues), 200.7 bits, see alignment E=4.3e-64 PF01641: SelR" amino acids 20 to 139 (120 residues), 188.7 bits, see alignment E=1.6e-60

Best Hits

Swiss-Prot: 86% identical to MSRB_RALSO: Peptide methionine sulfoxide reductase MsrB (msrB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to bpy:Bphyt_1923)

MetaCyc: 55% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T420 at UniProt or InterPro

Protein Sequence (140 amino acids)

>BPHYT_RS09545 peptide methionine sulfoxide reductase (Burkholderia phytofirmans PsJN)
MNKPDELKTDAPAVQKDDAEWRKQLSDIEYQVTRHAATERPFTGRYHDHWDRGIYDCVCC
GTPLFESDTKFDAGCGWPSYFKPIDGEVIKEKTDRSHGMLRIEVECKNCGAHLGHVFEDG
PAPTGLRYCINSAALQFEPK