Protein Info for BPHYT_RS09455 in Burkholderia phytofirmans PsJN

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 9 to 412 (404 residues), 674.8 bits, see alignment E=2.5e-207 PF06689: zf-C4_ClpX" amino acids 14 to 49 (36 residues), 70 bits, see alignment 5.4e-23 PF00493: MCM" amino acids 71 to 195 (125 residues), 24.4 bits, see alignment E=6.4e-09 PF13401: AAA_22" amino acids 113 to 194 (82 residues), 29 bits, see alignment E=5.3e-10 PF07724: AAA_2" amino acids 114 to 310 (197 residues), 117.7 bits, see alignment E=2.6e-37 PF07728: AAA_5" amino acids 116 to 193 (78 residues), 27.4 bits, see alignment E=1.3e-09 PF00004: AAA" amino acids 117 to 244 (128 residues), 59 bits, see alignment E=3.2e-19 PF10431: ClpB_D2-small" amino acids 317 to 388 (72 residues), 40.2 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 100% identical to CLPX_PARPJ: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 99% identity to bge:BC1002_1456)

MetaCyc: 76% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T404 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BPHYT_RS09455 ATP-dependent Clp protease ATP-binding subunit ClpX (Burkholderia phytofirmans PsJN)
MADKKGSNSEKLLYCSFCGKSQHEVKKLIAGPSVFICDECIDLCNEIIRDEAAGAGIEAG
LSKSDLPSPQEIREILDQYVIGQERAKKILAVAVYNHYKRLKHLDKKDEIELSKSNILLI
GPTGSGKTLLAQTLARLLNVPFVIADATTLTEAGYVGEDVENIIQKLLQNCNYEVDKAQR
GIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLVEGTMASVPPQGGRKHPNQDFIQV
DTTNILFICGGAFDGLEKVIVDRTEKTGIGFGASVKSKQDRDAGEVLREVEPEDLIKFGL
IPELIGRLPVVATLGKLDEVALMKILVEPKNALVKQYHKLFNMERVELEIRPAALQAVAR
KAIRRKTGARGLRSILEQALLDVMYDLPQMKGVSKVIIDDNVIDGDGKPLLIYEDAPKVA
GSN