Protein Info for BPHYT_RS09395 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 42 to 43 (2 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_1895)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3Z2 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BPHYT_RS09395 ABC transporter permease (Burkholderia phytofirmans PsJN)
MATLDDARPGAAPWLLSGPALLLFVGLLLVPLLLTLMLSFRVFSDTAGVTAAYTLANYWE
VVSDPYYGTIFLRTAGLAFAVTLLSIVLGVPETIVLARMKRPWQSLCLLVVLGPLLISVV
VRTLGWQILLGNNGVLNNLLQALHVTDEPIRLVFTMTGMIIALTHVLVPFMVMSVWATMQ
KLDPQVEWAGRSLGGSPFAVFRRVVLPQIMPGVLSGSIIVFALSASAFATPALIGGRRLK
VVATAAYDEFLGTLNWPLGASIAVLLLIANVAIVMGCSRLAERRFQHIFD