Protein Info for BPHYT_RS09390 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 206 to 207 (2 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 251 (171 residues), 54.3 bits, see alignment E=7.6e-19

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_1894)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3Z1 at UniProt or InterPro

Protein Sequence (265 amino acids)

>BPHYT_RS09390 ABC transporter permease (Burkholderia phytofirmans PsJN)
MKQNGILGLVYNAFFMTFILAPLAVVMLVAFTDKGFISMPFDGASLRWFRAIIENGDIVA
AFWLSVRLAFAAASIGVLLAVPAALAIARYRFPGRAALTSFFLSPMMIPAVVLGIAFLRF
LSLLHLSGSFWSLVCAHVIIVLPYALRLALSSAVGLDRDAERAALSCGASRFTAFRRVVL
PMIRTGVAGGWVLSFIQSFDELTMTIFVATPGTTTLPVAMYNQIAQTIDPLVASVSAVLI
VGTVLLMILLDRMVGLDRILIGETR